PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P06190_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31377.6 Da    PI: 4.7707
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P06190_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-2053106356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++++eq++ Le+ Fe ++++  e++ eLA+klgL+ rqV vWFqNrRa++k
  GSMUA_Achr3P06190_001  53 KKRRLSPEQVRLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWK 106
                            56689************************************************9 PP

2HD-ZIP_I/II132.12.1e-4253141290
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls eqv+lLE+sFe+e+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk++y +l +++++L ke+++Lr+
  GSMUA_Achr3P06190_001  53 KKRRLSPEQVRLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQLEHDFDRLKSSYGSLLSDHDSLLKENDRLRS 140
                            9*************************************************************************************98 PP

            HD-ZIP_I/II  90 e 90 
                            +
  GSMUA_Achr3P06190_001 141 Q 141
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.30148108IPR001356Homeobox domain
SMARTSM003891.3E-1951112IPR001356Homeobox domain
SuperFamilySSF466891.38E-1951119IPR009057Homeodomain-like
PfamPF000461.6E-1753106IPR001356Homeobox domain
CDDcd000861.31E-1853109No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2155115IPR009057Homeodomain-like
PRINTSPR000311.2E-67988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000311.2E-688104IPR000047Helix-turn-helix motif
PfamPF021839.5E-15108145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MLFATTDSGV FQITGARSAL AAAEGANKRR PFFTSPEELL EEEYYYDEQQ PDKKRRLSPE  60
QVRLLERSFE AENKLEPERK SELARKLGLQ PRQVAVWFQN RRARWKTKQL EHDFDRLKSS  120
YGSLLSDHDS LLKENDRLRS QAISLSFSPS LVISLTEKLQ SRTAASAGAA GIAGTKSDVQ  180
AAASVADPAT LAVQTKAEDR LSAGSGGSAV VDGEAAKQLV DSSEVSYFPE GYHCMGPVDG  240
GRVHSEEDDV SDEGCNYYSD GMFAAEHHHQ DEVDAQLDWW VWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391261.11e-167PREDICTED: homeobox-leucine zipper protein HOX16-like
SwissprotA2X9801e-75HOX16_ORYSI; Homeobox-leucine zipper protein HOX16
SwissprotQ6YWR49e-76HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLM0SC860.0M0SC86_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P06190_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-49homeobox 1